PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000460430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 369aa    MW: 41810.1 Da    PI: 7.4409
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000460430genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.6e-54101401129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++
  MDP0000460430  10 VPPGFRFHPTDEELLYYYLRKKVSYETIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIH 104
                    69****************************.9***************952444443456************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++  +g++ktLvfy+grap+g+ktdW+mheyrle
  MDP0000460430 105 LPNSXRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 140
                    **********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-615162IPR003441NAC domain
PROSITE profilePS5100558.14410162IPR003441NAC domain
PfamPF023658.6E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAAGNGQLTV PPGFRFHPTD EELLYYYLRK KVSYETIDLD VIREVDLNKL EPWDLKEKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLPNSXR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLE DDNTSADQVQ EDGWVVCRVF KKKNHNRGYQ PEFAHQDHRE  180
HDHFTNMKAS GSHVPILQDH YDHHQQKQNH HHLEGLYNYP SSFDHAGSMH LPQLFSPESA  240
VAASSFVSPH NINLNTMDIE CSQNLLRLTS TAAAAAAAAS GSCGLMQQQE RSFISGGDWS  300
FLDKLLASHQ NFDVNHSASQ TAKCNPSSST QQLSNSHDHD HVGTSSSTQQ RFPFQYLGCA  360
TDILKFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52716414167NO APICAL MERISTEM PROTEIN
1ut4_B3e-52716414167NO APICAL MERISTEM PROTEIN
1ut7_A3e-52716414167NO APICAL MERISTEM PROTEIN
1ut7_B3e-52716414167NO APICAL MERISTEM PROTEIN
4dul_A3e-52716414167NAC domain-containing protein 19
4dul_B3e-52716414167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371944.10.0PREDICTED: protein SOMBRERO
SwissprotQ9MA171e-130SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ810.0M5WZ81_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18420.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-120NAC family protein